Questions about using the command-line interface (CLI).

learn more… | top users | synonyms (6)

0
votes
0answers
10 views

Sipsak error: didn't received '200 OK' on register

How can I use sipsak to simulate a call on the CLI between SIP accounts? I can only run a local test using Asterisk successfully and would like to run a similar test or simulation using linphone, ...
-5
votes
0answers
29 views

Using the Top command with ps and kill [duplicate]

For my Computing Controlled Assessment I am looking into some of the basic commands for the Linux OS Debian. For the final question I have to write a short essay on using the top command along with ps ...
2
votes
1answer
63 views

Terminal command for changing ibus keyboard layout?

Is it possible to use terminal commands to switch between keyboard layouts in ibus? I can't see any GUI way to do it in XFCE.
2
votes
1answer
34 views

How to set cursor position with command/script?

I have a script which resets some things, and at the end of it I need it to set the cursor to certain coordinates, either to a custom set or to the centre of the screen (where it is reset to by ...
4
votes
2answers
136 views

How can I suspend the way that ubuntu does?

I would like a command I could map to a button or execute within my network. So far I know the command sudo pm-suspend but I could not make pmi action suspend work on either 12.04 nor 14.04 : Error ...
61
votes
2answers
9k views

How to protect Ubuntu from fork bomb

I heard someone talking about a fork bomb, I did some research and found some dreadful information about some strange looking characters people can have you type at the command line and as a result do ...
1
vote
1answer
12 views

How to run a perl script with arguments

I'm pretty new with Ubuntu and Linux and I need some help in order ton run a perl script. It may sound silly, but I need to run a perl (.pl) file, using a specific argument. The key is that when I run ...
1
vote
0answers
11 views

No output from service start/stop/restart command

I just installed Ubuntu 16.04 LTS and found that when I run usr@server:~$ sudo service <servicename> restart usr@server:~$ The service is restarted (I can see the status with service <...
2
votes
1answer
25 views

TAR a folder with exlcusions

I'm trying to create a compressed TAR file. I have a disk that I am going to destroy and would like to take one last snapshot of the /users folder but don't want the users .m4v .m4a and .mp3 files ...
18
votes
9answers
10k views

How to use guake at right side monitor in dual display environment

I want to use Guake at right monitor. So I added this ppa by sudo add-apt-repository ppa:cberner/guake, and sudo apt-get update. https://launchpad.net/~cberner/+archive/guake/+index?field....
0
votes
1answer
36 views

Create and remove directory using Terminal in Ubuntu 15.10 [duplicate]

I created a directory using the following command mkdir TEST. Now I am trying to remove it using rm TEST and rm TEST/ but it is showing the following error: cannot remove ‘TEST’: Is a directory ...
1
vote
1answer
42 views

Fix Package Dependencies?

I'm trying to install build-essential using sudo apt-get install build-essential like I'm supposed to. It returns with the error The following packages have unmet dependencies: build ...
24
votes
3answers
123k views

How can I check disk space used in a partition using the terminal in Ubuntu 12.04 LTS? [duplicate]

I am using Ubuntu 12.04 LTS and I was wondering if there is a command that can tell the space used in a partition using the terminal. Like I want to use the su command to change to a user called admin ...
0
votes
1answer
21 views

Cron - Check if enabled on boot

I have a script and configuration file. Configuration file contains information about if script will run or not (enabled or disabled). If enabled, script must run in predetermined intervals. I ...
3
votes
2answers
74 views

What is the difference between 'kill' and the 'k' option within 'top' in Linux?

I found out from http://www.tecmint.com/12-top-command-examples-in-linux/ (it's number 7 on that webpage) that you can use the k option to terminate a program. Would that work in the same way as ...
-1
votes
1answer
19 views

Using Terminal In 12.04 [duplicate]

When I try to use terminal, I put in a command and then it asks for my password. I type my password and nothing comes up on the screen. Help?
12
votes
5answers
34k views

Can I verbose output during a copy command processing?

Situation: If I entered a copy command like cp -rf /src/ /dsc/ then I am waiting several minutes for copy large directories. I forgot to put -v flag to verbose an output, Can I do it during copying?
12
votes
11answers
2k views

How to quickly move into and from deeply nested directories through CLI? [duplicate]

We know that using cd <directory> will open the directory, if it exists! Also, cd .. will take us up one level from the current working directory. But, when we have a nested dir with longer ...
0
votes
2answers
48 views

How to stop `clear` from clearing scrollback buffer

Initially I thought Unlimited scrolling was not working with the terminal application on 16.04. I have the option "limit scrollback to" unchecked. Some times it scrolls back some times it does not. ...
0
votes
0answers
15 views

Error installing VLC through Terminal GPG error [duplicate]

I tried Installing VLC media player in ubuntu 14.04 using information from page VLC Player installation ubuntu 14.04 Then, I ran: sudo apt-get update Terminal Returned: Reading package lists... ...
2
votes
3answers
38 views

folder not shown when being created by command line

I have an issue when I am creating a folder by command line. I create it by typing: mkdir TEST and it does not appear on the graphical desktop view. But if I type the command "ls" in the Terminal I ...
7
votes
3answers
4k views

How to set custom keyboard shortcuts from terminal?

How to set custom keyboard shortcuts from terminal for different Linux versions? Basically I want to know where Linux stores the keyboard shortcut files and how it can be edited. On my research I ...
0
votes
0answers
13 views

NEIGHBOR-BASED IDS for wsn [on hold]

please help I've downloaded the program NEIGHBOR-BASED IDS FOR TINYOS from source forget(nbids) But I need steps to run a program please help
3
votes
2answers
67 views

Can't permanently export PATH variable with custom path

I've installed composer and the laravel installer which is now located unter ~/.config/composer/vendor/bin. I want to use laravel directly as a command from anywhere, so I tried to add the directory ...
3
votes
4answers
3k views

Cut column from list

How can I cut second column from the following list from terminal? 56 267 57 235 58 255 59 283
59
votes
1answer
77k views

What do the STAT column values in ps mean?

In the STAT column of ps there are a load of letters that don't really make much sense. What do they mean? Here's an example of ps aux | head: USER PID %CPU %MEM VSZ RSS TTY STAT ...
69
votes
6answers
145k views

Running programs in the background from terminal

How do I run a program in the background of a shell, with the ability to close the shell while leaving the program running? Lets say my UI is having problems or for some reason, I need to boot up a ...
0
votes
1answer
25 views

Get key name from keycode

I am writing a shell script that uses xinput, and I would like to get a human-readable description of what the user has typed using the keycode from xinput. For example, A generates 38. Ctrl is 37. ...
73
votes
10answers
191k views

How do you reset a USB device from the command line?

Is it possible to reset the connection of a USB device, without physically disconnecting/connecting from the PC? Specifically, my device is a digital camera. I'm using gphoto2, but lately I get "...
9
votes
9answers
1k views

Short-cut for switching to a given directory

In the Ubuntu terminal I find myself spending considerable time to switch to a particular directory every time the computer starts up. Is there some way I can make this process easier? Is there some ...
1
vote
2answers
30 views

how to delete particular number or letter before an symbols (|) using grep command

I have N number of sequence in a file like this >668|CAX10446 conserved hypothetical protein MSIRGVGGNGNSRIPSHNGDGSNRRSQNTKNKVEDRVRSLYSSRSNENRESPYAVVDVSSMIESTPTSGE ...
2
votes
2answers
1k views

How do I use emerge to install zynaddsubfx presets?

I found a script on the internet for installing zynaddsubfx presets but when I tried to use it on the command line I wasn't able to run it. Here is where I get stuck: emerge -s zynaddsubfx. This is ...
110
votes
3answers
22k views

Why is a virtual terminal “virtual”, and what/why/where is the “real” terminal?

I hope the question is self-explanatory. My understanding is that gnome-terminal and konsole are virtual terminals, and they are basically serving the same purpose, i.e. a command line environment ...
7
votes
2answers
543 views

Count number of files in a folder per day

I can find number of all files in folder but I got pretty large number. find . -type f | wc -l #find number of files in DIR ls -lrt #list all files order by date How to ...
0
votes
2answers
203 views

“sudo ecryptfs-recover-private” gives “find: ‘/run/user/1000/gvfs’: Permission denied” after botched (?) upgrade

EDIT 1: I reinstalled 16.04 having booted through the CD but with the HDD installed, now I can read the "readme.txt" and I can click on the "access-your-private-data.desktop" and it seems to run for a ...
106
votes
5answers
190k views

Execute sudo without Password?

Inspired by this question.... I am the sole person using my system with 12.04. Every time I issue a sudo command; the system asks for the user password (which is good in its own way). However I was ...
0
votes
0answers
16 views

PLINK execution of: echo -e “%UNIXPW%\n” ^| sudo -S nginx -t -c, works OK on one, fails on another

My batch file runs a PLINK script in Ubuntu 16.04 LTS, which works correctly on my own VM/Ubuntu. The same command fails in when run on a different VM/ubuntu 16.04 LTS. echo -e "%UNIXPW%\n" ^| sudo -...
1
vote
0answers
27 views

Upstart services work in SSH session, but not in local terminal session

If I open a local terminal, and attempt to start an upstart service I get this error: service rsync status status: Unknown job: rsync But if I SSH in as the same user, it works fine: service rsync ...
1
vote
1answer
38 views

How to use command line set default application? [duplicate]

I use command line for set default application. Like set default application, VLC.
2
votes
0answers
48 views

spaces affect the firefox commands in terminal [on hold]

firefox -private & This command open private browsing . but the same command firefox -private& without space between ampersand and the -private option will only open normal browsing ...
0
votes
0answers
23 views

Creating A Drag and Drop Bash Script for wipe

WARNING: This question contains dangerous commands. Do not execute these commands on your own computer unless you wish to lose data. I have been using the command like program 'wipe' for ages with ...
0
votes
1answer
23 views

difference kill -9 pid and kill pid command [duplicate]

what is the difference between kill -9 pid and kill pid command ? Do they have different behavior ? i know that -9 is for "SIGKILL" signal
2
votes
1answer
65 views

Problems making Afl-fuzzer using BinUtils on 14.04

Aim: I am trying to setup and run Afl Fuzzer (link), as part of following an online course. Info: I'm running Ubuntu 14.04 on dvd. In the video the teacher uses the BinUtils 2.25 package, and ...
4
votes
3answers
263 views

What do I have to do to have a program I downloaded show up in “Search your computer and online resources”?

I downloaded Android Studio, and untared it in /usr/local as I read I should to avoid it eating /home space. Then I added the path to the /bin folder to the PATH variable, but I still can't execute it ...
0
votes
1answer
55 views

Cron job to set screen brightness not working in ubuntu 14.04

In the terminal, I ran: crontab -e Then I added the following cronjob in the file 26 21 * * * /usr/bin/xbacklight -set 80 This was supposed to set the brightness to 80% at 9:26 PM. But its not ...
21
votes
5answers
24k views

'Insufficient permissions' error on `adb push` command on 12.04

When I tried to push my apk file into a tablet, I got this error, please help me out. adb server is out of date. killing... * daemon started successfully * error: insufficient permissions for ...
1
vote
4answers
11k views

How can I copy/paste files in the terminal window (SSH)? [duplicate]

I am new to ubuntu and my friend told me to SSH into my IPod so i can put/remove songs on it. I've been succesfully ssh'ing into it but i do not know how to copy and paste my songs from my Home ...
0
votes
0answers
20 views

New user can't log in [on hold]

I need help. I just installed today on drive d of my laptop. After install it took me a while to fathom out that my password did not show, but finally fathomed it out. Problem now is I have a black ...
1
vote
3answers
1k views

How can I fetch random words from an electronic dictionary database or text file?

Is there a way to get random words from the dictionary databases like from the dict-wn or freedict's packages? I'm looking for a way to do that by either using a bash script or try a command tool if ...
0
votes
0answers
14 views

What is the problem with “/usr/bin/dpkg”? [duplicate]

I have a problem on terminal. I have tried to install apache2 but the terminal displays an error: How to fix the problem?