Questions about using the command-line interface (CLI).

learn more… | top users | synonyms (6)

0
votes
1answer
17 views

How to stop `clear` from clearing scrollback buffer

Initially I thought Unlimited scrolling was not working with the terminal application on 16.04. I have the option "limit scrollback to" unchecked. Some times it scrolls back some times it does not. ...
11
votes
10answers
2k views

How to quickly move into and from deeply nested directories through CLI?

We know that using cd <directory> will open the directory, if it exists! Also, cd .. will take us up one level from the current working directory. But, when we have a nested dir with longer ...
2
votes
2answers
12 views

Can't permanently export PATH variable with custom path

I've installed composer and the laravel installer which is now located unter ~/.config/composer/vendor/bin. I want to use laravel directly as a command from anywhere, so I tried to add the directory ...
3
votes
4answers
3k views

Cut column from list

How can I cut second column from the following list from terminal? 56 267 57 235 58 255 59 283
2
votes
2answers
739 views

Why won't the bashless shell run my C programs?

I have no problem running my C programs by switching to their directory and starting them with ./. However, I'm not sure why changing to the directory and then typing sh [Program Name] gives me this ...
59
votes
1answer
77k views

What do the STAT column values in ps mean?

In the STAT column of ps there are a load of letters that don't really make much sense. What do they mean? Here's an example of ps aux | head: USER PID %CPU %MEM VSZ RSS TTY STAT ...
69
votes
6answers
145k views

Running programs in the background from terminal

How do I run a program in the background of a shell, with the ability to close the shell while leaving the program running? Lets say my UI is having problems or for some reason, I need to boot up a ...
0
votes
1answer
24 views

Get key name from keycode

I am writing a shell script that uses xinput, and I would like to get a human-readable description of what the user has typed using the keycode from xinput. For example, A generates 38. Ctrl is 37. ...
73
votes
10answers
191k views

How do you reset a USB device from the command line?

Is it possible to reset the connection of a USB device, without physically disconnecting/connecting from the PC? Specifically, my device is a digital camera. I'm using gphoto2, but lately I get "...
8
votes
9answers
1k views

Short-cut for switching to a given directory

In the Ubuntu terminal I find myself spending considerable time to switch to a particular directory every time the computer starts up. Is there some way I can make this process easier? Is there some ...
1
vote
2answers
24 views

folder not shown when being created by command line

I have an issue when I am creating a folder by command line. I create it by typing: mkdir TEST and it does not appear on the graphical desktop view. But if I type the command "ls" in the Terminal I ...
1
vote
2answers
30 views

how to delete particular number or letter before an symbols (|) using grep command

I have N number of sequence in a file like this >668|CAX10446 conserved hypothetical protein MSIRGVGGNGNSRIPSHNGDGSNRRSQNTKNKVEDRVRSLYSSRSNENRESPYAVVDVSSMIESTPTSGE ...
2
votes
2answers
1k views

How do I use emerge to install zynaddsubfx presets?

I found a script on the internet for installing zynaddsubfx presets but when I tried to use it on the command line I wasn't able to run it. Here is where I get stuck: emerge -s zynaddsubfx. This is ...
110
votes
3answers
22k views

Why is a virtual terminal “virtual”, and what/why/where is the “real” terminal?

I hope the question is self-explanatory. My understanding is that gnome-terminal and konsole are virtual terminals, and they are basically serving the same purpose, i.e. a command line environment ...
7
votes
2answers
530 views

Count number of files in a folder per day

I can find number of all files in folder but I got pretty large number. find . -type f | wc -l #find number of files in DIR ls -lrt #list all files order by date How to ...
1
vote
0answers
12 views

Cron - Check if enabled on boot

I have a script and configuration file. Configuration file contains information about if script will run or not (enabled or disabled). If enabled, script must run in predetermined intervals. I ...
0
votes
2answers
194 views

“sudo ecryptfs-recover-private” gives “find: ‘/run/user/1000/gvfs’: Permission denied” after botched (?) upgrade

EDIT 1: I reinstalled 16.04 having booted through the CD but with the HDD installed, now I can read the "readme.txt" and I can click on the "access-your-private-data.desktop" and it seems to run for a ...
105
votes
5answers
190k views

Execute sudo without Password?

Inspired by this question.... I am the sole person using my system with 12.04. Every time I issue a sudo command; the system asks for the user password (which is good in its own way). However I was ...
0
votes
0answers
12 views

PLINK execution of: echo -e “%UNIXPW%\n” ^| sudo -S nginx -t -c, works OK on one, fails on another

My batch file runs a PLINK script in Ubuntu 16.04 LTS, which works correctly on my own VM/Ubuntu. The same command fails in when run on a different VM/ubuntu 16.04 LTS. echo -e "%UNIXPW%\n" ^| sudo -...
1
vote
0answers
24 views

Upstart services work in SSH session, but not in local terminal session

If I open a local terminal, and attempt to start an upstart service I get this error: service rsync status status: Unknown job: rsync But if I SSH in as the same user, it works fine: service rsync ...
1
vote
1answer
37 views

How to use command line set default application? [duplicate]

I use command line for set default application. Like set default application, VLC.
2
votes
0answers
46 views

spaces affect the firefox commands in terminal [on hold]

firefox -private & This command open private browsing . but the same command firefox -private& without space between ampersand and the -private option will only open normal browsing ...
0
votes
0answers
23 views

Creating A Drag and Drop Bash Script for wipe

WARNING: This question contains dangerous commands. Do not execute these commands on your own computer unless you wish to lose data. I have been using the command like program 'wipe' for ages with ...
0
votes
1answer
20 views

difference kill -9 pid and kill pid command [duplicate]

what is the difference between kill -9 pid and kill pid command ? Do they have different behavior ? i know that -9 is for "SIGKILL" signal
2
votes
1answer
64 views

Problems making Afl-fuzzer using BinUtils on 14.04

Aim: I am trying to setup and run Afl Fuzzer (link), as part of following an online course. Info: I'm running Ubuntu 14.04 on dvd. In the video the teacher uses the BinUtils 2.25 package, and ...
4
votes
3answers
261 views

What do I have to do to have a program I downloaded show up in “Search your computer and online resources”?

I downloaded Android Studio, and untared it in /usr/local as I read I should to avoid it eating /home space. Then I added the path to the /bin folder to the PATH variable, but I still can't execute it ...
0
votes
1answer
53 views

Cron job to set screen brightness not working in ubuntu 14.04

In the terminal, I ran: crontab -e Then I added the following cronjob in the file 26 21 * * * /usr/bin/xbacklight -set 80 This was supposed to set the brightness to 80% at 9:26 PM. But its not ...
21
votes
5answers
24k views

'Insufficient permissions' error on `adb push` command on 12.04

When I tried to push my apk file into a tablet, I got this error, please help me out. adb server is out of date. killing... * daemon started successfully * error: insufficient permissions for ...
1
vote
4answers
11k views

How can I copy/paste files in the terminal window (SSH)? [duplicate]

I am new to ubuntu and my friend told me to SSH into my IPod so i can put/remove songs on it. I've been succesfully ssh'ing into it but i do not know how to copy and paste my songs from my Home ...
0
votes
0answers
20 views

New user can't log in [on hold]

I need help. I just installed today on drive d of my laptop. After install it took me a while to fathom out that my password did not show, but finally fathomed it out. Problem now is I have a black ...
1
vote
3answers
1k views

How can I fetch random words from an electronic dictionary database or text file?

Is there a way to get random words from the dictionary databases like from the dict-wn or freedict's packages? I'm looking for a way to do that by either using a bash script or try a command tool if ...
0
votes
0answers
14 views

What is the problem with “/usr/bin/dpkg”? [duplicate]

I have a problem on terminal. I have tried to install apache2 but the terminal displays an error: How to fix the problem?
0
votes
0answers
9 views

Terminal is closing upon opening [duplicate]

Terminal is closing immediately after opening. I managed to open an alternative terminal with: env SHELL=/bin/sh gnome-terminal When I type ''bash'' in the alternative terminal: # bash ...
0
votes
1answer
9k views

when building u-boot /bin/bash: arm-none-linux-gnueabi-gcc: command not found

I am currently running Ubuntu 12.0.4 on a 64 bit machine. I have an AM335X development board. Along with the kit came the compressed kernel (linux 3,2), rootfs, u-boot, and ARM cross compiler (arm-...
0
votes
0answers
15 views

when I perform service privoxy start in bash, I can't find the binding port 8118

I have modified the configured file about privoxy in /etc/privoxy/config file. listen-address 0.0.0.0:8118 forward-socks5 / 127.0.0.1:1080 . When I perform sudo service ...
15
votes
2answers
4k views

Why do I need root privileges to umount a drive at the command line, but not in Nautilus? How to change that?

When I insert a thumb drive, media card, or USB hard drive, to unmount it via the command line, I need to use: sudo umount /media/the_device But, I can unmount the device in a file manager like ...
0
votes
0answers
20 views

yarn-env.sh : command not found

I have Hadoop 2.7.2 installed on Ubuntu 16.04. When I run the command: start-yarn.sh It gives the following output: starting yarn daemons /usr/local/hadoop-2.7.2/etc/hadoop/yarn-env.sh: line 122: ...
10
votes
7answers
68k views

How to display file properties via terminal?

What is the command line that displays file informations (or properties), such as in GUI method Display properties in GNOME? I know that ls -l shows properties; but how to display the same ...
2
votes
1answer
519 views

Getting gnome-terminal to run tmux on start

I'm trying to figure out how to get my gnome-terminal to launch run tmux -2 on starting. I have tried modifying the Exec lines in the gnome-terminal.desktop file to Exec=gnome-terminal -e -tmux -2 and ...
1
vote
1answer
549 views

How to execute an arbitrary command when open a new gnome profile terminal?

I want to create a profile terminal that executes this command rvm use 1.9.2 and leave me in the prompt after choosing my ruby version. user@user-desktop:~/Sites/RailsApp$ rvm use 1.9.2 Using /home/...
0
votes
0answers
10 views

run virtualenv in new terminal tab automatically

I am using virtualenv, so to start I have to say source some/long/path/bin/activate Sometimes (very often, in fact) I want to create another tab in terminal, to edit another script, or to run ...
0
votes
0answers
21 views

Stuck at grub rescue and when I type “ls” it comes up with “unknown command”

I'm running Ubuntu 12.04 on an old HP Compaq. When I boot the computer it goes straight to grub rescue saying: "error: symbol not found: "grub_register_command_proi"". After looking on various forums ...
2
votes
1answer
25 views

Is there a CLI software center that supports reviews and ratings?

If I can help it, I'd rather not use the GUI, so I don't want to use gnome-software when looking for new software, is there some sort of CLI 'software center' which also has the ability to show and ...
2
votes
0answers
43 views

ALSA Keeps Throwing Me Errors, really Frustrating

The Situation So my sound cards aren't totally fried, and everything works fine, it's just annoying when working with python scripts and Speech Recognition for Python. This being the result of my ...
2
votes
2answers
150 views

Combining 2 commands

I need to write a shell script for converting characters in a file to lowercase and replace non alpha chars to _. I have separate command for both the above. How to give a file as argument and make ...
1
vote
1answer
2k views

How is it possible that I can execute JAR file from shell?

I always thought, only executables in UNIX/Linux are ELF-files and shell scripts. But i found that it is possible to use just $ ./file.jar instead of $ java -jar file.jar. How are JAR-files special? ...
1
vote
1answer
32 views

The -o parameter in aria2c can't rename the downloaded file

aria2c -S /home/se.torrent Files: idx|path/length ===+=========================================================================== 1|./test.mkv |283MiB (297,429,086) ---+---...
1
vote
0answers
30 views

What are these memory strings? What do they do? [migrated]

Recently, I dumped my memory strings (just because I could) using sudo cat /dev/mem | strings. Upon reviewing this dump, I noticed some very interesting things: .symtab .strtab .shstrtab .note.gnu....
21
votes
3answers
46k views

iTerm 2 equivalent

Is there an iTerm2 (terminal application for Mac OS) equivalent for Ubuntu? Amongst the many features it adds the one I'm after is the "hotkey window", where you can overlay/hide a translucent ...
5
votes
3answers
3k views

Google query from terminal

Is there a way to launch a google query from the terminal? Like starting up google (as in firefox www.google.com) but with a search query? It would be nice to not have to install any extra programs ...