Questions about using the command-line interface (CLI).

learn more… | top users | synonyms (6)

0
votes
1answer
16 views

Terminal windows open with “]#Curl: command not found”

This seems to be related to my ~/.bash_aliases file. The message only appears when I open a new terminal window and when I try source ~/.bash_aliases. Ive made sure curl and all related libraries are ...
0
votes
1answer
17 views

How to check memory type and speed? [duplicate]

I want to get more RAM for my computer, and I understand that to get the right type of RAM I have to know the memory type and speed (minimum and maximum as far as I understand). So how do I find these ...
0
votes
1answer
14 views

Problem installing pip: pip command not found

Having problems installing pip and not sure why can someone help me find out why the pip is returning "-bash: pip: command not found"? $ echo $PATH /Library/Frameworks/Python.framework/Versions/3.5/...
3
votes
4answers
389 views

Why aren't there any man pages for disown or other Ubuntu commands?

phatez@phatez-laptop:~$ help GNU bash, version 4.3.46(1)-release (x86_64-pc-linux-gnu) These shell commands are defined internally. Type `help' to see this list. Type `help name' to find out more ...
1
vote
1answer
14 views

Removing ghostscript alias

I'm using zsh which uses gs as an alias for git status. But on Ubuntu, gs is an alias for ghostscript. I tried uninstalling ghostscript, but then I get this instead: The program 'gs' is currently not ...
0
votes
0answers
24 views

How to restore a broken Deja Dup backup manually

For various reasons (possibly this bug) a Deja Dup backup I made failed. I have been following this guide to restore my backup by hand. The steps have been: In the folder containing the backups run: ...
0
votes
0answers
10 views

Sipsak error: didn't received '200 OK' on register

How can I use sipsak to simulate a call on the CLI between SIP accounts? I can only run a local test using Asterisk successfully and would like to run a similar test or simulation using linphone, ...
-5
votes
0answers
39 views

Using the Top command with ps and kill [duplicate]

For my Computing Controlled Assessment I am looking into some of the basic commands for the Linux OS Debian. For the final question I have to write a short essay on using the top command along with ps ...
1
vote
1answer
14 views

How to run a perl script with arguments

I'm pretty new with Ubuntu and Linux and I need some help in order ton run a perl script. It may sound silly, but I need to run a perl (.pl) file, using a specific argument. The key is that when I run ...
1
vote
0answers
14 views

No output from service start/stop/restart command

I just installed Ubuntu 16.04 LTS and found that when I run usr@server:~$ sudo service <servicename> restart usr@server:~$ The service is restarted (I can see the status with service <...
2
votes
1answer
37 views

How to set cursor position with command/script?

I have a script which resets some things, and at the end of it I need it to set the cursor to certain coordinates, either to a custom set or to the centre of the screen (where it is reset to by ...
3
votes
2answers
79 views

What is the difference between 'kill' and the 'k' option within 'top' in Linux?

I found out from http://www.tecmint.com/12-top-command-examples-in-linux/ (it's number 7 on that webpage) that you can use the k option to terminate a program. Would that work in the same way as ...
-1
votes
1answer
20 views

Using Terminal In 12.04 [duplicate]

When I try to use terminal, I put in a command and then it asks for my password. I type my password and nothing comes up on the screen. Help?
0
votes
1answer
36 views

Create and remove directory using Terminal in Ubuntu 15.10 [duplicate]

I created a directory using the following command mkdir TEST. Now I am trying to remove it using rm TEST and rm TEST/ but it is showing the following error: cannot remove ‘TEST’: Is a directory ...
0
votes
0answers
16 views

Error installing VLC through Terminal GPG error [duplicate]

I tried Installing VLC media player in ubuntu 14.04 using information from page VLC Player installation ubuntu 14.04 Then, I ran: sudo apt-get update Terminal Returned: Reading package lists... ...
1
vote
1answer
42 views

Fix Package Dependencies?

I'm trying to install build-essential using sudo apt-get install build-essential like I'm supposed to. It returns with the error The following packages have unmet dependencies: build ...
2
votes
1answer
25 views

TAR a folder with exlcusions

I'm trying to create a compressed TAR file. I have a disk that I am going to destroy and would like to take one last snapshot of the /users folder but don't want the users .m4v .m4a and .mp3 files ...
0
votes
0answers
13 views

NEIGHBOR-BASED IDS for wsn [on hold]

please help I've downloaded the program NEIGHBOR-BASED IDS FOR TINYOS from source forget(nbids) But I need steps to run a program please help
3
votes
2answers
70 views

Can't permanently export PATH variable with custom path

I've installed composer and the laravel installer which is now located unter ~/.config/composer/vendor/bin. I want to use laravel directly as a command from anywhere, so I tried to add the directory ...
0
votes
2answers
51 views

How to stop `clear` from clearing scrollback buffer

Initially I thought Unlimited scrolling was not working with the terminal application on 16.04. I have the option "limit scrollback to" unchecked. Some times it scrolls back some times it does not. ...
2
votes
3answers
38 views

folder not shown when being created by command line

I have an issue when I am creating a folder by command line. I create it by typing: mkdir TEST and it does not appear on the graphical desktop view. But if I type the command "ls" in the Terminal I ...
1
vote
2answers
30 views

how to delete particular number or letter before an symbols (|) using grep command

I have N number of sequence in a file like this >668|CAX10446 conserved hypothetical protein MSIRGVGGNGNSRIPSHNGDGSNRRSQNTKNKVEDRVRSLYSSRSNENRESPYAVVDVSSMIESTPTSGE ...
0
votes
1answer
21 views

Cron - Check if enabled on boot

I have a script and configuration file. Configuration file contains information about if script will run or not (enabled or disabled). If enabled, script must run in predetermined intervals. I ...
0
votes
0answers
19 views

PLINK execution of: echo -e “%UNIXPW%\n” ^| sudo -S nginx -t -c, works OK on one, fails on another

My batch file runs a PLINK script in Ubuntu 16.04 LTS, which works correctly on my own VM/Ubuntu. The same command fails in when run on a different VM/ubuntu 16.04 LTS. echo -e "%UNIXPW%\n" ^| sudo -...
0
votes
1answer
25 views

Get key name from keycode

I am writing a shell script that uses xinput, and I would like to get a human-readable description of what the user has typed using the keycode from xinput. For example, A generates 38. Ctrl is 37. ...
2
votes
0answers
48 views

spaces affect the firefox commands in terminal [on hold]

firefox -private & This command open private browsing . but the same command firefox -private& without space between ampersand and the -private option will only open normal browsing ...
12
votes
11answers
2k views

How to quickly move into and from deeply nested directories through CLI? [duplicate]

We know that using cd <directory> will open the directory, if it exists! Also, cd .. will take us up one level from the current working directory. But, when we have a nested dir with longer ...
7
votes
2answers
545 views

Count number of files in a folder per day

I can find number of all files in folder but I got pretty large number. find . -type f | wc -l #find number of files in DIR ls -lrt #list all files order by date How to ...
1
vote
0answers
27 views

Upstart services work in SSH session, but not in local terminal session

If I open a local terminal, and attempt to start an upstart service I get this error: service rsync status status: Unknown job: rsync But if I SSH in as the same user, it works fine: service rsync ...
0
votes
1answer
24 views

difference kill -9 pid and kill pid command [duplicate]

what is the difference between kill -9 pid and kill pid command ? Do they have different behavior ? i know that -9 is for "SIGKILL" signal
1
vote
1answer
38 views

How to use command line set default application? [duplicate]

I use command line for set default application. Like set default application, VLC.
4
votes
3answers
263 views

What do I have to do to have a program I downloaded show up in “Search your computer and online resources”?

I downloaded Android Studio, and untared it in /usr/local as I read I should to avoid it eating /home space. Then I added the path to the /bin folder to the PATH variable, but I still can't execute it ...
0
votes
0answers
20 views

New user can't log in [on hold]

I need help. I just installed today on drive d of my laptop. After install it took me a while to fathom out that my password did not show, but finally fathomed it out. Problem now is I have a black ...
0
votes
0answers
14 views

What is the problem with “/usr/bin/dpkg”? [duplicate]

I have a problem on terminal. I have tried to install apache2 but the terminal displays an error: How to fix the problem?
0
votes
0answers
9 views

Terminal is closing upon opening [duplicate]

Terminal is closing immediately after opening. I managed to open an alternative terminal with: env SHELL=/bin/sh gnome-terminal When I type ''bash'' in the alternative terminal: # bash ...
0
votes
0answers
21 views

yarn-env.sh : command not found

I have Hadoop 2.7.2 installed on Ubuntu 16.04. When I run the command: start-yarn.sh It gives the following output: starting yarn daemons /usr/local/hadoop-2.7.2/etc/hadoop/yarn-env.sh: line 122: ...
0
votes
0answers
12 views

run virtualenv in new terminal tab automatically

I am using virtualenv, so to start I have to say source some/long/path/bin/activate Sometimes (very often, in fact) I want to create another tab in terminal, to edit another script, or to run ...
0
votes
0answers
23 views

Stuck at grub rescue and when I type “ls” it comes up with “unknown command”

I'm running Ubuntu 12.04 on an old HP Compaq. When I boot the computer it goes straight to grub rescue saying: "error: symbol not found: "grub_register_command_proi"". After looking on various forums ...
2
votes
1answer
27 views

Is there a CLI software center that supports reviews and ratings?

If I can help it, I'd rather not use the GUI, so I don't want to use gnome-software when looking for new software, is there some sort of CLI 'software center' which also has the ability to show and ...
1
vote
0answers
30 views

What are these memory strings? What do they do? [migrated]

Recently, I dumped my memory strings (just because I could) using sudo cat /dev/mem | strings. Upon reviewing this dump, I noticed some very interesting things: .symtab .strtab .shstrtab .note.gnu....
2
votes
2answers
150 views

Combining 2 commands

I need to write a shell script for converting characters in a file to lowercase and replace non alpha chars to _. I have separate command for both the above. How to give a file as argument and make ...
-1
votes
0answers
21 views

Trying to open chromium browser from putty/terminal [closed]

I am trying to execute the following command on terminal (CentOs6.7): chromium-browser http://google.com/ I got the following Error: (chromium-browser:2036): Gtk-WARNING **: cannot open display:
0
votes
1answer
23 views

Delete all hidden files recursively in current directory [duplicate]

I have a directory which contains hidden files and by that I mean, not just the files whose name starts with . but also the files whose name contains ~ character at the end like somefile.txt~. I want ...
0
votes
1answer
27 views

Ubuntu alias rename directory issue

I have Ubuntu 14.04 Trusty Tahr installed in my system. I have created following alias in my '~/.bashrc' file to make renaming directories recursively in current folder, as easy to use short command. ...
0
votes
0answers
25 views

How to know the utilization of intel CPU and GPU in Linux? [closed]

In ubuntu, to know the time taken by CPU to run a program we would use 'time' in terminal. Whereas in case of intel GPU, we would use 'intel_gpu_time'. But in case of CentOS 'time' command works. But '...
-1
votes
0answers
16 views

install mrtg-2.17.4 ploblem?

I'm install mrtg-2.17.4 on Ubuntu 14.04 follow http://oss.oetiker.ch/mrtg/doc/mrtg.en.html ,but can't install how should i do ,help? Thanks. ~/Downloads/mrtg-2.17.4$ ./configure --with-gd=/...
4
votes
1answer
245 views

Everytime I use a sudo command it says >>>/etc/sudoers.d/90-cloudimg-ubuntu: syntax error near line 1<<<

I got the following error while using the sudo apt-get update command. :~$sudo apt-get update /etc/sudoers.d/90-cloudimg-ubuntu: syntax error near line 1 <<< sudo: parse error in /etc/...
3
votes
0answers
19 views

How to re-create the x-terminal-emulator alternative?

I've just installed Ubuntu Gnome 16.04 and while tryng to add "terminix" as the default terminal emulator I've messed up really bad the x-terminal-emulator alternative, totally my fault! I'd enter ...
2
votes
1answer
35 views

Can I execute a program with a sudo command through a shortcut? [duplicate]

I've created a file containing these two lines of code: #!/bin/sh sudo sh -c "sync; echo 3 > /proc/sys/vm/drop_caches" I have ticked (from 'properties') the appropriate box to run the file as a ...
0
votes
0answers
15 views

when I perform service privoxy start in bash, I can't find the binding port 8118

I have modified the configured file about privoxy in /etc/privoxy/config file. listen-address 0.0.0.0:8118 forward-socks5 / 127.0.0.1:1080 . When I perform sudo service ...